*Form: This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.; *Seq: AKDVEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLTVIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV; *Accession#: NP_181254.1; NM_129273.4; P43287; *NCBI Summary: a member of the plasma membrane intrinsic protein subfamily PIP2. localizes to the plasma membrane and exhibits water transport activity in Xenopus oocyte. expressed specifically in the vascular bundles and protein level increases slightly during leaf dev; *Uniprot Summary: Function: Water channel required to facilitate the transport of water across cell membrane. Plays an predominant role in root water uptake process in conditions of reduced transpiration, and in osmotic fluid transport. Its function is impaired by Hg2+. Inhibited by cytosolic acidosis which occurs during anoxia in roots. Ref.1 Ref.5 Ref.7Subcellular location: Cell membrane; Multi-pass membrane protein Ref.5. Tissue specificity: Predominantly expressed in the root, with a strong expression in the cortex, endodermis, and stele. Ref.5 Ref.6Domain: Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).Sequence similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family. PIP (TC 1.A.8.11) subfamily. [View classification]