*Form: This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.; *Purity: >90%; *Tag Information: His tagged; *Species: Mycoplasma pneumoniae (strain ATCC 29342 / M129); *Seq: MKLPPRRKLKLFLLAWMLVLFSALIVLATLILVQHNNTELTEVKSELSPLNVVLHAEEDTVQIQGKPITEQAWFIPTVAGCFGFSALAIILGLAIGLPIVKRKEKRLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR; *Accession#: NP_110141.1; NC_000912.1; P75330; *Uniprot Summary: Function: Adhesin necessary for successful cytadherence and virulence.Subcellular location: Cell projection › attachment organelle membrane; Multi-pass membrane protein. Note: Integral and surface exposed membrane protein that localizes to the membrane at the attachment organelle.Domain: 13 hexapeptides with consensus sequence were found at the carboxy end between AA 177 and 267 in a proline-rich domain.Miscellaneous: Spontaneous hemadsorption-negative mutants M6 and M7 exhibit a truncated P30 adhesin.